PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G062700.1
Common NamePHAVU_009G062700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 225aa    MW: 24868.3 Da    PI: 8.7257
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G062700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.2e-183176147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        +g+W++eEd +l ++v ++G+++W++I+r++  gR++k+c++rw + 
  Phvul.009G062700.1 31 KGPWSAEEDRILTRLVDRYGPRNWSLISRYIK-GRSGKSCRLRWCNQ 76
                        79*****************************9.***********985 PP

2Myb_DNA-binding57.62.8e-1885127347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +++++Ed+ ++ a++q+G++ W+tIar ++ gRt++ +k++w++ 
  Phvul.009G062700.1  85 PFSPQEDDTIIAAHAQYGNR-WATIARLLP-GRTDNAVKNHWNST 127
                         89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.8952681IPR017930Myb domain
SuperFamilySSF466891.04E-3128124IPR009057Homeodomain-like
SMARTSM007174.9E-163079IPR001005SANT/Myb domain
PfamPF002492.5E-173176IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-243284IPR009057Homeodomain-like
CDDcd001677.10E-153375No hitNo description
SMARTSM007179.5E-1682130IPR001005SANT/Myb domain
PROSITE profilePS5129421.6482132IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2385131IPR009057Homeodomain-like
PfamPF002493.2E-1585127IPR001005SANT/Myb domain
CDDcd001671.52E-1285128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MEAFNRTSST ASSSSDSSSS DSNHNNPHRI KGPWSAEEDR ILTRLVDRYG PRNWSLISRY  60
IKGRSGKSCR LRWCNQLSPT VQHRPFSPQE DDTIIAAHAQ YGNRWATIAR LLPGRTDNAV  120
KNHWNSTLKR RAKALLDINV NNNASSEGAT SSAPSRSFED DPLTALTLAP PGISNASVAE  180
DAVLDHRASP ENAPAGFWDM MRDVIAREVR EYVSSSFSDN SNFH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-422613253159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-422613253159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136655.11e-164hypothetical protein PHAVU_009G062700g
TrEMBLV7ASW01e-164V7ASW0_PHAVU; Uncharacterized protein
STRINGGLYMA06G04010.11e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50743256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.15e-59myb domain protein 77